PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013609260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 359aa    MW: 40438.6 Da    PI: 5.1623
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013609260.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl
   XP_013609260.1 14 KGAWTTEEDKKLISYIHEHGEGGWRDIPQKAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.77.5e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
   XP_013609260.1  67 RGEFSYEEEQIIIMLHASRGNK-WSVIARHLP-KRTDNEVKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129423.985965IPR017930Myb domain
SuperFamilySSF466891.09E-2811108IPR009057Homeodomain-like
SMARTSM007175.5E-141363IPR001005SANT/Myb domain
PfamPF002492.4E-171461IPR001005SANT/Myb domain
CDDcd001675.72E-111661No hitNo description
Gene3DG3DSA:1.10.10.609.6E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129418.77666116IPR017930Myb domain
SMARTSM007172.2E-1366114IPR001005SANT/Myb domain
PfamPF002492.1E-1367112IPR001005SANT/Myb domain
CDDcd001675.46E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009682Biological Processinduced systemic resistance
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MSRKPCCVGE GLKKGAWTTE EDKKLISYIH EHGEGGWRDI PQKAGLKRCG KSCRLRWANY  60
LKPDIKRGEF SYEEEQIIIM LHASRGNKWS VIARHLPKRT DNEVKNYWNT HLKKRLIDQG  120
IDPLTHKPLA SNPNPATPRT SEGQDDSNPI NLDEQSQSGS MSPKSLPHSS SSCNLQTIIN  180
SDETPRNNGS LSSKKCRFKK LSSTSKLLNK VATKASSIGN MLSASMEGSL IRSTTLSPCL  240
NDVFSETSXI SQMDEFDPFS HSSEQHITDH MKEDINMDFD LNNSEFDFSQ FIEQFSNIEA  300
EEANAIGGYN QDLLLSDVSS TSVDEDNVMQ NITGWSNYLV DDSDFPYDTN QDFDDKNFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24121165108B-MYB
1h8a_C2e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013609260.10.0PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB29
SwissprotQ9FLR10.0MYB29_ARATH; Transcription factor MYB29
TrEMBLA0A0D3EH730.0A0A0D3EH73_BRAOL; Uncharacterized protein
STRINGBra005949.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07690.11e-167myb domain protein 29